<?xml version="1.0" encoding="utf-8" standalone="yes" ?>
<rss version="2.0" xmlns:atom="http://www.w3.org/2005/Atom">
  <channel>
    <title>template on Sparks Lab</title>
    <link>/tags/template/</link>
    <description>Recent content in template on Sparks Lab</description>
    <generator>Hugo -- gohugo.io</generator>
    <lastBuildDate>Thu, 23 Jan 2020 00:00:00 +0000</lastBuildDate>
    
	<atom:link href="/tags/template/index.xml" rel="self" type="application/rss+xml" />
    
    
    <item>
      <title>SPOT-CBP: Template-based identification of carbohydrate-binding proteins</title>
      <link>/server/spot-cbp/</link>
      <pubDate>Thu, 23 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-cbp/</guid>
      <description>E-mail address (optional):    Target (optional):    PDB File:     Input structure File MUST be in PDB format    
## Example output</description>
    </item>
    
    <item>
      <title>SPOT-Ligand2: Small molecule virtual screening by binding homology on expanded template library</title>
      <link>/server/spot-ligand2/</link>
      <pubDate>Wed, 22 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-ligand2/</guid>
      <description>E-mail address (optional):    Target (optional):    PDB File:     Custom library (Optional):     Input structure File MUST be in PDB format    Input compound library MUST be in SMILES format - maximum 10,000 compounds    
## Example output</description>
    </item>
    
    <item>
      <title>SPOT-Ligand: Small molecule virtual screening by binding homology search</title>
      <link>/server/spot-ligand/</link>
      <pubDate>Wed, 22 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-ligand/</guid>
      <description>E-mail address (optional):    Target (optional):    PDB File:     Input structure File MUST be in PDB format    
## Example output</description>
    </item>
    
    <item>
      <title>SPARKS-X: Protein fold recognition</title>
      <link>/server/sparks-x/</link>
      <pubDate>Wed, 15 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/sparks-x/</guid>
      <description>E-mail address (optional):    Target (optional):    Input your protein Sequences:  Maximum: 500 AA, Only one protein sequence at a time   &amp;gt;Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status  
## Example output
## Local download</description>
    </item>
    
    <item>
      <title>SPOT-peptide: Template-based prediction of peptide binding proteins and peptide binding sites</title>
      <link>/server/spot-peptide/</link>
      <pubDate>Wed, 15 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-peptide/</guid>
      <description>E-mail address (optional):    Target (optional):    PDB File:     List of PDB IDs:     Input structure File MUST be in PDB format OR a list of 5-character PDB ids - ID+chain e.g. 1elrA    
## Example output
## Help page</description>
    </item>
    
  </channel>
</rss>