/tags/stability/ Recent content in stability on Sparks Lab Hugo -- gohugo.io Wed, 05 Feb 2020 00:00:00 +0000 /server/ease-mm/ Wed, 05 Feb 2020 00:00:00 +0000 /server/ease-mm/ EASE-MM supports prediction of missense mutations specified as amino acid substitutions (protein input) or as nsSNV variants (genome input) in the GRCh37/hg19 assembly of the human genome. E-mail address (optional): Target (optional): Input your sequence and mutations: SEQ: my_short_seq RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILE MUT: A40G L16V G4A Check the Job Queue Status Publication: