secondary structure on Sparks Lab /tags/secondary-structure/ Recent content in secondary structure on Sparks Lab Hugo -- gohugo.io Mon, 10 Feb 2020 00:00:00 +0000 SPIDER3: Capturing non-local interactions by long short term memory bidirectional recurrent neural networks for improving prediction of protein secondary structure, backbone angles, contact numbers, and solvent accessibility /server/spider3/ Mon, 10 Feb 2020 00:00:00 +0000 /server/spider3/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. E-mail address (optional): Target (optional): Input your protein Sequences: Maximum: 10 sequences at a time (FASTA format) >Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status ## Example output SPOT-1D-LM:Reaching Alignment-profile-based Accuracy in Predicting Protein Secondary and Tertiary Structural Properties without Alignment /server/spot-1d-lm/ Mon, 10 Feb 2020 00:00:00 +0000 /server/spot-1d-lm/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. -- The model only take upto a maximum of 1022 amino acid sequence. -- Currently, the Webserver is down until further notice. Please refer to the GITHUB for the local standalone. E-mail address: Target (optional): Input your protein Sequences: Maximum: 100 sequences at a time. SPOT-1D-Single: Improving the Single-Sequence-Based Prediction of Protein Secondary Structure, Backbone Angles, Solvent Accessibility and Half-Sphere Exposures using a Large Training Set and Ensembled Deep Learning /server/spot-1d-single/ Mon, 10 Feb 2020 00:00:00 +0000 /server/spot-1d-single/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. E-mail address: Target (optional): Input your protein Sequences: Maximum: 100 sequences at a time. Single Line Sequence only and “>prot_id”only (FASTA format) >6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status SPOT-1D: Improving prediction of protein secondary structure, backbone angles, solvent accessibility and contact numbers by using predicted contact maps and an ensemble of recurrent and residual convolutional neural networks /server/spot-1d/ Mon, 10 Feb 2020 00:00:00 +0000 /server/spot-1d/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. E-mail address (optional): Target (optional): Input your protein Sequences: Maximum: 10 sequences at a time, less than 750AA each (FASTA format) >Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status