<?xml version="1.0" encoding="utf-8" standalone="yes" ?>
<rss version="2.0" xmlns:atom="http://www.w3.org/2005/Atom">
  <channel>
    <title>protein on Sparks Lab</title>
    <link>/tags/protein/</link>
    <description>Recent content in protein on Sparks Lab</description>
    <generator>Hugo -- gohugo.io</generator>
    <lastBuildDate>Thu, 24 Jun 2021 00:00:00 +0000</lastBuildDate>
    
	<atom:link href="/tags/protein/index.xml" rel="self" type="application/rss+xml" />
    
    
    <item>
      <title>SPOT-Contact-Single: Improving Single-Sequence-Based Prediction of Protein Contact Map using a Transformer Language Model, Large Training Set and Ensembled Deep Learning</title>
      <link>/server/spot-contact-single/</link>
      <pubDate>Thu, 24 Jun 2021 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-contact-single/</guid>
      <description>Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.
  E-mail address:    Target (optional):    Input your protein Sequences:  Maximum: 50 sequences at a time. Single Line Sequence only and &amp;ldquo;&amp;gt;prot_id&amp;rdquo;only (FASTA format)   &amp;gt;6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status</description>
    </item>
    
    <item>
      <title>DDIG: Detecting DIsease-causing Genetic variations</title>
      <link>/server/ddig/</link>
      <pubDate>Sun, 13 Sep 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/ddig/</guid>
      <description>DDIG currently supports prediction of protein-coding
non-frameshifting (NFS) indels,
frameshifting (FS) indels,
nonsense (protein-truncating) and
synonymous (same-sense, silent) variants in the GRCh37/hg19 assembly of the human genome.
 E-mail address (optional):    Target (optional):    Input your variants (format and examples):        
Check the Job Queue Status  

Publications:
Synonymous variants:
M. Livingstone, L. Folkman, Y. Yang, P.</description>
    </item>
    
    <item>
      <title>SPOT-Disorder-Single: Single Sequence Protein disorder prediction</title>
      <link>/server/spot-disorder-single/</link>
      <pubDate>Fri, 28 Feb 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-disorder-single/</guid>
      <description>E-mail address (optional):    Target (optional):    Input your protein Sequences:  FASTA format   &amp;gt;Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status  
## Example output</description>
    </item>
    
    <item>
      <title>SPRINT-Gly: Predicting N- and O-linked glycosylation sites of human and mouse proteins by using sequence and predicted structural properties</title>
      <link>/server/sprint-gly/</link>
      <pubDate>Thu, 27 Feb 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/sprint-gly/</guid>
      <description>Submit  E-mail address (optional):    Target (optional):    Input your protein sequence:  Only one sequence at a time   &amp;gt;NP_035565.1 extracellular superoxide dismutase [Cu-Zn] precursor [Mus musculus] MLAFLFYGLLLAACGSVTMSNPGESSFDLADRLDPVEKIDRLDLVEKIGDTHAKVLEIWMELGRRREVDAAEMHAICRVQPSATLPPDQPQITGLVLFRQLGPGSRLEAYFSLEGFPAEQNASNRAIHVHEFGDLSQGCDSTGPHYNPMEVPHPQHPGDFGNFVVRNGQLWRHRVGLTASLAGPHAILGRSVVVHAGEDDLGKGGNQASLQNGNAGRRLACCVVGTSSSAAWESQTKERKKRRRESECKTT     Species:  Human Mouse     Glycosylation type:  N-linked O-linked     header&#34; is required -- 
Check the Job Queue Status  
Help page ## Example output</description>
    </item>
    
    <item>
      <title>SPIDER3: Capturing non-local interactions by long short term memory bidirectional recurrent neural networks for improving prediction of protein secondary structure, backbone angles, contact numbers, and solvent accessibility</title>
      <link>/server/spider3/</link>
      <pubDate>Mon, 10 Feb 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spider3/</guid>
      <description>Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.
  E-mail address (optional):    Target (optional):    Input your protein Sequences:  Maximum: 10 sequences at a time (FASTA format)   &amp;gt;Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status  
## Example output</description>
    </item>
    
    <item>
      <title>SPOT-1D-LM:Reaching Alignment-profile-based Accuracy in Predicting Protein Secondary and Tertiary Structural Properties without Alignment</title>
      <link>/server/spot-1d-lm/</link>
      <pubDate>Mon, 10 Feb 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-1d-lm/</guid>
      <description>Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. -- The model only take upto a maximum of 1022 amino acid sequence. --  Currently, the Webserver is down until further notice. Please refer to the GITHUB for the local standalone.
  E-mail address:    Target (optional):    Input your protein Sequences:  Maximum: 100 sequences at a time.</description>
    </item>
    
    <item>
      <title>SPOT-1D-Single: Improving the Single-Sequence-Based Prediction of Protein Secondary Structure, Backbone Angles, Solvent Accessibility and Half-Sphere Exposures using a Large Training Set and Ensembled Deep Learning</title>
      <link>/server/spot-1d-single/</link>
      <pubDate>Mon, 10 Feb 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-1d-single/</guid>
      <description>Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.
  E-mail address:    Target (optional):    Input your protein Sequences:  Maximum: 100 sequences at a time. Single Line Sequence only and &amp;ldquo;&amp;gt;prot_id&amp;rdquo;only (FASTA format)   &amp;gt;6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status</description>
    </item>
    
    <item>
      <title>SPOT-1D: Improving prediction of protein secondary structure, backbone angles, solvent accessibility and contact numbers by using predicted contact maps and an ensemble of recurrent and residual convolutional neural networks</title>
      <link>/server/spot-1d/</link>
      <pubDate>Mon, 10 Feb 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-1d/</guid>
      <description>Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.
  E-mail address (optional):    Target (optional):    Input your protein Sequences:  Maximum: 10 sequences at a time, less than 750AA each (FASTA format)   &amp;gt;Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status</description>
    </item>
    
    <item>
      <title>SPOT-Contact: Accurate prediction of protein contact maps by coupling residual two-dimensional bidirectional long short-term memory with convolutional neural networks</title>
      <link>/server/spot-contact/</link>
      <pubDate>Mon, 10 Feb 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-contact/</guid>
      <description>Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.
  E-mail address (optional):    Target (optional):    Input your protein Sequences:  Maximum: 10 sequences at a time, less than 750AA each (FASTA format)   &amp;gt;Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status</description>
    </item>
    
    <item>
      <title>EASE-MM: Prediction of mutation-induced stability changes</title>
      <link>/server/ease-mm/</link>
      <pubDate>Wed, 05 Feb 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/ease-mm/</guid>
      <description>EASE-MM supports prediction of missense mutations
specified as amino acid substitutions (protein input)
or as nsSNV variants (genome input)
in the GRCh37/hg19 assembly of the human genome.

 E-mail address (optional):    Target (optional):    Input your sequence and mutations:    SEQ: my_short_seq RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILE MUT: A40G L16V G4A     
Check the Job Queue Status  

Publication:</description>
    </item>
    
    <item>
      <title>SPOT-Disorder: Protein disorder prediction v1.0</title>
      <link>/server/spot-disorder/</link>
      <pubDate>Fri, 31 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-disorder/</guid>
      <description>Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.
  E-mail address (optional):    Target (optional):    Input your protein Sequences:  Maximum: 10 sequences at a time (FASTA format)   &amp;gt;Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status  
## Example output</description>
    </item>
    
    <item>
      <title>SPOT-CBP: Template-based identification of carbohydrate-binding proteins</title>
      <link>/server/spot-cbp/</link>
      <pubDate>Thu, 23 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-cbp/</guid>
      <description>E-mail address (optional):    Target (optional):    PDB File:     Input structure File MUST be in PDB format    
## Example output</description>
    </item>
    
    <item>
      <title>SPOT-Disorder2: Protein disorder prediction</title>
      <link>/server/spot-disorder2/</link>
      <pubDate>Thu, 23 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-disorder2/</guid>
      <description>Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.
  E-mail address (optional):    Target (optional):    Input your protein Sequences:  Maximum: 10 sequences at a time, less than 750AA each (FASTA format)   &amp;gt;Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status</description>
    </item>
    
    <item>
      <title>SPOT-MoRF: Molecular recognition Features in Intrinsically Disordered Regions by Transfer Learning</title>
      <link>/server/spot-morf/</link>
      <pubDate>Thu, 23 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-morf/</guid>
      <description>Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.
  E-mail address (optional):    Target (optional):    Input your protein Sequences:  Maximum: 10 sequences at a time, less than 750AA each (FASTA format)   &amp;gt;Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status</description>
    </item>
    
    <item>
      <title>SPOT-Ligand2: Small molecule virtual screening by binding homology on expanded template library</title>
      <link>/server/spot-ligand2/</link>
      <pubDate>Wed, 22 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-ligand2/</guid>
      <description>E-mail address (optional):    Target (optional):    PDB File:     Custom library (Optional):     Input structure File MUST be in PDB format    Input compound library MUST be in SMILES format - maximum 10,000 compounds    
## Example output</description>
    </item>
    
    <item>
      <title>SPOT-Ligand: Small molecule virtual screening by binding homology search</title>
      <link>/server/spot-ligand/</link>
      <pubDate>Wed, 22 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-ligand/</guid>
      <description>E-mail address (optional):    Target (optional):    PDB File:     Input structure File MUST be in PDB format    
## Example output</description>
    </item>
    
    <item>
      <title>SPARKS-X: Protein fold recognition</title>
      <link>/server/sparks-x/</link>
      <pubDate>Wed, 15 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/sparks-x/</guid>
      <description>E-mail address (optional):    Target (optional):    Input your protein Sequences:  Maximum: 500 AA, Only one protein sequence at a time   &amp;gt;Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status  
## Example output
## Local download</description>
    </item>
    
    <item>
      <title>SPOT-peptide: Template-based prediction of peptide binding proteins and peptide binding sites</title>
      <link>/server/spot-peptide/</link>
      <pubDate>Wed, 15 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-peptide/</guid>
      <description>E-mail address (optional):    Target (optional):    PDB File:     List of PDB IDs:     Input structure File MUST be in PDB format OR a list of 5-character PDB ids - ID+chain e.g. 1elrA    
## Example output
## Help page</description>
    </item>
    
    <item>
      <title>SPOT-Contact: Accurate prediction of protein contact maps by coupling residual two-dimensional bidirectional long short-term memory with convolutional neural networks</title>
      <link>/server/spot-contact-casp/</link>
      <pubDate>Sat, 10 Feb 2001 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-contact-casp/</guid>
      <description>Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.
  E-mail address (optional):    Target (optional):    Input your protein Sequences:  Maximum: 10 sequences at a time, less than 750AA each (FASTA format)   &amp;gt;Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status</description>
    </item>
    
  </channel>
</rss>