<?xml version="1.0" encoding="utf-8" standalone="yes" ?>
<rss version="2.0" xmlns:atom="http://www.w3.org/2005/Atom">
  <channel>
    <title>MoRF on Sparks Lab</title>
    <link>/tags/morf/</link>
    <description>Recent content in MoRF on Sparks Lab</description>
    <generator>Hugo -- gohugo.io</generator>
    <lastBuildDate>Thu, 23 Jan 2020 00:00:00 +0000</lastBuildDate>
    
	<atom:link href="/tags/morf/index.xml" rel="self" type="application/rss+xml" />
    
    
    <item>
      <title>SPOT-MoRF: Molecular recognition Features in Intrinsically Disordered Regions by Transfer Learning</title>
      <link>/server/spot-morf/</link>
      <pubDate>Thu, 23 Jan 2020 00:00:00 +0000</pubDate>
      
      <guid>/server/spot-morf/</guid>
      <description>Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.
  E-mail address (optional):    Target (optional):    Input your protein Sequences:  Maximum: 10 sequences at a time, less than 750AA each (FASTA format)   &amp;gt;Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP     
Check the Job Queue Status</description>
    </item>
    
  </channel>
</rss>