inter-residue contact prediction on Sparks Lab

inter-residue contact prediction on Sparks Lab /tags/inter-residue-contact-prediction/ Recent content in inter-residue contact prediction on Sparks Lab Hugo -- gohugo.io Thu, 24 Jun 2021 00:00:00 +0000 SPOT-Contact-Single: Improving Single-Sequence-Based Prediction of Protein Contact Map using a Transformer Language Model, Large Training Set and Ensembled Deep Learning /server/spot-contact-single/ Thu, 24 Jun 2021 00:00:00 +0000 /server/spot-contact-single/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. E-mail address: Target (optional): Input your protein Sequences: Maximum: 50 sequences at a time. Single Line Sequence only and “>prot_id”only (FASTA format) >6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status