rheffernan on Sparks Lab /authors/rheffernan/ Recent content in rheffernan on Sparks Lab Hugo -- gohugo.io Mon, 10 Feb 2020 00:00:00 +0000 SPIDER3: Capturing non-local interactions by long short term memory bidirectional recurrent neural networks for improving prediction of protein secondary structure, backbone angles, contact numbers, and solvent accessibility /server/spider3/ Mon, 10 Feb 2020 00:00:00 +0000 /server/spider3/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. E-mail address (optional): Target (optional): Input your protein Sequences: Maximum: 10 sequences at a time (FASTA format) >Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status ## Example output