/authors/lukas/ Recent content in lukas on Sparks Lab Hugo -- gohugo.io Sun, 13 Sep 2020 00:00:00 +0000 /server/ddig/ Sun, 13 Sep 2020 00:00:00 +0000 /server/ddig/ DDIG currently supports prediction of protein-coding non-frameshifting (NFS) indels, frameshifting (FS) indels, nonsense (protein-truncating) and synonymous (same-sense, silent) variants in the GRCh37/hg19 assembly of the human genome. E-mail address (optional): Target (optional): Input your variants (format and examples): Check the Job Queue Status Publications: Synonymous variants: M. Livingstone, L. Folkman, Y. Yang, P. /server/ease-mm/ Wed, 05 Feb 2020 00:00:00 +0000 /server/ease-mm/ EASE-MM supports prediction of missense mutations specified as amino acid substitutions (protein input) or as nsSNV variants (genome input) in the GRCh37/hg19 assembly of the human genome. E-mail address (optional): Target (optional): Input your sequence and mutations: SEQ: my_short_seq RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILE MUT: A40G L16V G4A Check the Job Queue Status Publication: