jhanson on Sparks Lab /authors/jhanson/ Recent content in jhanson on Sparks Lab Hugo -- gohugo.io Fri, 28 Feb 2020 00:00:00 +0000 SPOT-Disorder-Single: Single Sequence Protein disorder prediction /server/spot-disorder-single/ Fri, 28 Feb 2020 00:00:00 +0000 /server/spot-disorder-single/ E-mail address (optional): Target (optional): Input your protein Sequences: FASTA format >Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status ## Example output SPOT-1D: Improving prediction of protein secondary structure, backbone angles, solvent accessibility and contact numbers by using predicted contact maps and an ensemble of recurrent and residual convolutional neural networks /server/spot-1d/ Mon, 10 Feb 2020 00:00:00 +0000 /server/spot-1d/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. E-mail address (optional): Target (optional): Input your protein Sequences: Maximum: 10 sequences at a time, less than 750AA each (FASTA format) >Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status SPOT-Contact: Accurate prediction of protein contact maps by coupling residual two-dimensional bidirectional long short-term memory with convolutional neural networks /server/spot-contact/ Mon, 10 Feb 2020 00:00:00 +0000 /server/spot-contact/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. E-mail address (optional): Target (optional): Input your protein Sequences: Maximum: 10 sequences at a time, less than 750AA each (FASTA format) >Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status SPOT-Disorder: Protein disorder prediction v1.0 /server/spot-disorder/ Fri, 31 Jan 2020 00:00:00 +0000 /server/spot-disorder/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. E-mail address (optional): Target (optional): Input your protein Sequences: Maximum: 10 sequences at a time (FASTA format) >Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status ## Example output SPOT-Disorder2: Protein disorder prediction /server/spot-disorder2/ Thu, 23 Jan 2020 00:00:00 +0000 /server/spot-disorder2/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. E-mail address (optional): Target (optional): Input your protein Sequences: Maximum: 10 sequences at a time, less than 750AA each (FASTA format) >Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status SPOT-MoRF: Molecular recognition Features in Intrinsically Disordered Regions by Transfer Learning /server/spot-morf/ Thu, 23 Jan 2020 00:00:00 +0000 /server/spot-morf/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. E-mail address (optional): Target (optional): Input your protein Sequences: Maximum: 10 sequences at a time, less than 750AA each (FASTA format) >Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status SPOT-Contact: Accurate prediction of protein contact maps by coupling residual two-dimensional bidirectional long short-term memory with convolutional neural networks /server/spot-contact-casp/ Sat, 10 Feb 2001 00:00:00 +0000 /server/spot-contact-casp/ Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly. E-mail address (optional): Target (optional): Input your protein Sequences: Maximum: 10 sequences at a time, less than 750AA each (FASTA format) >Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP Check the Job Queue Status